• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Tubby Antibody

Tubby Antibody (R32733)

  Catalog No Formulation Size Price (USD)  
Image R32733 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) COLO320 and 2) MCF7 cell lysate with Tubby antibody at 0.5ug/ml. Predicted molecular weight ~56/62 kDa (isoforms 1/2).
Flow cytometry testing of human HeLa cells with Tubby antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Tubby antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P50607
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This Tubby antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Tubby protein homolog is a protein that in humans is encoded by the TUB gene. This gene encodes a member of the Tubby family of bipartite transcription factors. The encoded protein may play a role in obesity and sensorineural degradation. The crystal structure has been determined for a similar protein in mouse, and it functions as a membrane-bound transcription regulator that translocates to the nucleus in response to phosphoinositide hydrolysis. Two transcript variants encoding distinct isoforms have been identified for this gene.

Application Notes

Optimal dilution of the Tubby antibody should be determined by the researcher.

Immunogen

Amino acids 395-429 (VHERVSIRPRNEHETLLARWQNKNTESIIELQNKT) from the human protein were used as the immunogen for the Tubby antibody.

Storage

After reconstitution, the Tubby antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.