- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
TSLP Antibody / Epithelial Derived Cytokine Antibody (R32884)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
R32884 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
|
| Availability | 1-3 business days |
| Species Reactivity | Mouse, Rat |
| Format | Antigen affinity purified |
| Host | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide |
| UniProt | Q9JIE6 |
| Localization | Secreted |
| Applications | Western Blot : 0.5-1ug/ml |
| Limitations | This TSLP Antibody / Epithelial Derived Cytokine Antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
TSLP Antibody / Epithelial Derived Cytokine Antibody recognizes thymic stromal lymphopoietin (TSLP), a secreted cytokine that plays a central role in epithelial barrier immunity and the initiation of type 2 immune responses. Produced primarily by epithelial cells in the skin, airways and gastrointestinal tract, TSLP is released in response to environmental injury, allergens, pathogens and inflammatory stimuli. By activating dendritic cells and influencing multiple innate and adaptive immune cell populations, TSLP serves as an important link between epithelial tissues and immune regulation. NSJ Bioreagents offers high-quality TSLP Antibody reagents for investigating cytokine signaling and inflammatory disease mechanisms.
TSLP promotes communication between epithelial cells and immune cells by stimulating dendritic cells, T cells, mast cells, eosinophils, basophils and innate lymphoid cells. Through these interactions, TSLP contributes to allergic sensitization, mucosal immunity and tissue repair while helping coordinate protective immune responses at barrier surfaces. Dysregulated TSLP expression has been associated with chronic inflammatory disorders, particularly asthma, atopic dermatitis, allergic rhinitis and eosinophilic gastrointestinal diseases. Consequently, TSLP Antibody is widely used to investigate epithelial cytokine biology and immune regulation.
Beyond allergic disease, TSLP has emerged as an important mediator in cancer biology, fibrosis, autoimmune disorders and host defense against infection. Depending on tissue context, TSLP signaling may promote protective immunity or contribute to chronic inflammation and disease progression. Increasing interest in therapeutic strategies targeting the TSLP pathway has further expanded research into its regulation, receptor signaling and downstream immune effects. As a result, TSLP continues to be an important biomarker for studies of epithelial biology, cytokine networks and inflammatory signaling.
An TSLP Antibody is a valuable reagent for investigating epithelial cytokine signaling, barrier immunity and type 2 immune responses. An Epithelial Derived Cytokine Antibody supports research involving allergic inflammation, asthma, atopic dermatitis, mucosal immunology, epithelial biology and immune cell communication.
Researchers studying cytokine signaling, allergic inflammation and immune regulation may also be interested in our Cytokine Antibodies page, featuring antibodies against key mediators of innate and adaptive immune responses.
Optimal dilution of the TSLP Antibody / Epithelial Derived Cytokine Antibody should be determined by the researcher.
Amino acids QEMAQEVQNICLNQTSQILRLWYSFMQSPE were used as the immunogen for the TSLP antibody.
After reconstitution, the TSLP antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
TSLP antibody, Thymic Stromal Lymphopoietin antibody, Epithelial Derived Cytokine antibody, TSLP Cytokine antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
