- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Sp5 Antibody (R32265)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32265 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 419 |
| Availability | 1-3 business days |
| Species Reactivity | Human |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q6BEB4 |
| Localization | Nuclear |
| Applications | Western blot : 0.1-0.5ug/ml Immunohistochemistry (FFPE) : 0.5-1ug/ml |
| Limitations | This Sp5 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Sp5 is mapped to 2q31.1. It is a member of the Sp family of zinc finger transcription factors. Like other family members, the Sp5 protein contains a Cys2His2 zinc finger DNA binding domain at the C-terminus. Elevated expression of Sp5 has been noted in several human tumors including hepatocellular carcinoma, gastric cancer and colon cancer.
Optimal dilution of the Sp5 antibody should be determined by the researcher.
Amino acids DFAQYQSQIAALLQTKAPLAATARRCRRCR of human Sp5 were used as the immunogen for the Sp5 antibody.
After reconstitution, the Sp5 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
