- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
SP2 Antibody (R32182)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32182 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 419 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | Q02086 |
| Localization | Nuclear |
| Applications | Western blot : 0.1-0.5ug/ml |
| Limitations | This SP2 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Transcription factor Sp2 is a protein that in humans is encoded by the SP2 gene. This gene encodes a member of the Sp subfamily of Sp/XKLF transcription factors. Sp family proteins are sequence-specific DNA-binding proteins characterized by an amino-terminal trans-activation domain and three carboxy-terminal zinc finger motifs. This protein contains the least conserved DNA-binding domain within the Sp subfamily of proteins, and its DNA sequence specificity differs from the other Sp proteins. It localizes primarily within subnuclear foci associated with the nuclear matrix, and can activate or in some cases repress expression from different promoters.
Optimal dilution of the SP2 antibody should be determined by the researcher.
Amino acids QVVQIPQQALRVVQAASATLPTVPQKPSQNFQ of human SP2 were used as the immunogen for the SP2 antibody.
After reconstitution, the SP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz