• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> RXFP2 Antibody / Relaxin Receptor 2

RXFP2 Antibody / Relaxin Receptor 2 (RQ4608)

  Catalog No Formulation Size Price (USD)  
Image RQ4608 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human SHG-44 cell lysate with RXFP2 antibody at 0.5ug/ml. Predicted molecualr weight ~86 kDa.
Flow cytometry testing of human U251 cells with RXFP2 antibody at 1ug/10^6 cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= RXFP2 antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q8WXD0
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/10^6 cells
Limitations This RXFP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Relaxin/insulin-like family peptide receptor 2, also known as RXFP2, is a human G-protein coupled receptor. It is mapped to 13q13.1. This gene encodes a member of the GPCR (G protein-coupled, 7-transmembrane receptor) family. Mutations in this gene are associated with cryptorchidism. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the RXFP2 antibody should be determined by the researcher.

Immunogen

Amino acids MIVFLVFKHLFSLRLITMFFLLHFIVLINVKDFALTQ were used as the immunogen for the RXFP2 antibody.

Storage

After reconstitution, the RXFP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.