- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
RRM2 Antibody (R32063)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R32063 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| UniProt | P31350 |
| Localization | Cytoplasmic, membrane |
| Applications | Western blot : 0.1-0.5ug/ml IHC (FFPE) : 0.5-1ug/ml |
| Limitations | This RRM2 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Ribonucleoside-diphosphate reductase subunit M2, also known as ribonucleotide reductase small subunit, is an enzyme that in humans is encoded by the RRM2 gene. It is mapped to 2p25-p24. This gene encodes one of two non-identical subunits for ribonucleotide reductase. This reductase catalyzes the formation of deoxyribonucleotides from ribonucleotides. Synthesis of the encoded protein (M2) is regulated in a cell-cycle dependent fashion. Transcription from this gene can initiate from alternative promoters, which results in two isoforms which differ in the lengths of their N-termini. Related pseudogenes have been identified on chromosomes 1 and X.
Optimal dilution of the RRM2 antibody should be determined by the researcher.
Amino acids MLSLRVPLAPITDPQQLQLSPLKGLSLVDKENT of human RRM2 were used as the immunogen for the RRM2 antibody.
After reconstitution, the RRM2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
