• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> PML Antibody / Promyelocytic leukemia protein

PML Antibody / Promyelocytic leukemia protein (R32553)

  Catalog No Formulation Size Price (USD)  
Image R32553 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of mouse testis lysate with PML antibody at 0.5ug/ml. Expected molecular weight: multiple isoforms from 47-97 kDa.
IHC testing of FFPE mouse spleen with PML antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q60953
Localization Nuclear, cytoplasmic (isoform dependent)
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This PML antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Promyelocytic leukemia protein functions via its association with PML-nuclear bodies (PML-NBs) in a wide range of important cellular processes, including tumor suppression, transcriptional regulation, apoptosis, senescence, DNA damage response, and viral defense mechanisms.

Application Notes

Optimal dilution of the PML antibody should be determined by the researcher.

Immunogen

Amino acids 140-177 (LADFWCFECEQLICSKCFEAHQWYLKHEARPLADLRDN) from the mouse protein were used as the immunogen for the PML antibody.

Storage

After reconstitution, the PML antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.