• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> PARVA Antibody / Parvin alpha

PARVA Antibody / Parvin alpha (R32338)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32338 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Western blot testing of 1) rat liver, 2) human HeLa, 3) SW620 and 4) mouse HEPA lysate with PARVA antibody. Predicted/observed molecular weight ~42 kDa.
›
Western blot testing of 1) rat liver, 2) human HeLa, 3) SW620 and 4) mouse HEPA lysate with PARVA antibody. Predicted/observed molecular weight ~42 kDa.
IHC testing of FFPE human breast cancer tissue with PARVA antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q9NVD7
Localization Cytoplasmic, membrane
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This PARVA antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P
    Reactivity : Human
  • Applications : WB, IHC-P, ELISA (peptide)
    Reactivity : Human, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Rat

Description

Parvin alpha is a protein that in humans is encoded by the PARVA gene. It is located on 11p15.3. PARVA belongs to the parvin family of actin-binding proteins. Parvins are associated with focal contacts and contain calponin homology domains that bind to actin filaments. The encoded protein is part of the integrin-linked kinase signaling complex and plays a role in cell adhesion, motility and survival.

Application Notes

Optimal dilution of the PARVA antibody should be determined by the researcher.

Immunogen

Amino acids QKLQTVLEKINETLKLPPRSIKWNVDSVHAK of human Parvin alpha were used as the immunogen for the PARVA antibody.

Storage

After reconstitution, the PARVA antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Parvin alpha antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.