• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Musashi 1 Antibody / MSI1

Musashi 1 Antibody / MSI1 (RQ5992)

  Catalog No Formulation Size Price (USD)  
Image RQ5992 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Flow cytometry testing of human A549 cells with Musashi 1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= Musashi 1 antibody.
Western blot testing of human 1) U-2 OS, 2) T-47D and 3) COLO-320 lysate with Musashi 1 antibody. Predicted molecular weight ~39 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O43347
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Direct ELISA : 0.1-0.5ug/ml
Limitations This Musashi 1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

RNA-binding protein Musashi homolog 1 is a protein that in humans is encoded by the MSI1 gene. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.

Application Notes

Optimal dilution of the Musashi 1 antibody should be determined by the researcher.

Immunogen

Amino acids KMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRD from the human protein were used as the immunogen for the Musashi 1 antibody.

Storage

After reconstitution, the Musashi 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.