• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> MMP3 Antibody

MMP3 Antibody (R31680)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31680 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of MMP3 antibody and Lane 1: human placenta; 2: U20S; 3: HeLa; 4: PANC; 5: COLO320. Predicted molecular weight ~54 kDa.
›
Western blot testing of MMP3 antibody and Lane 1: human placenta; 2: U20S; 3: HeLa; 4: PANC; 5: COLO320. Predicted molecular weight ~54 kDa.
Western blot testing of MMP3 antibody and recombinant human protein (0.5ng)
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Gene ID 4314
Applications Western blot : 0.5-1ug/ml
Limitations This MMP3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Stromelysin-1, also known as Matrix metalloproteinase-3 (MMP-3), is an enzyme that in humans is encoded by the MMP3 gene. It is mapped to 11q22.2. Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix and during tissue remodeling in normal physiological processes, such as embryonic development and reproduction, as well as in disease processes, such as arthritis, and tumour metastasis. The MMP3 enzyme degrades collagen types II, III, IV, IX, and X, proteoglycans, fibronectin, laminin, and elastin. In addition, it can also activate other MMPs such as MMP1, MMP7, and MMP9, rendering MMP3 crucial in connective tissue remodeling. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation.

Application Notes

The stated application concentrations are suggested starting amounts. Titration of the MMP3 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Immunogen

An amino acid sequence from the C-terminal of human MMP3 (RFDEKRNSMEPGFPKQIAEDFPGIDSKIDA) was used as the immunogen for this MMP3 antibody.

Storage

After reconstitution, the MMP3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Matrix Metalloproteinase antibodies

   2.   View all MMP3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.