• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> MLX Antibody / Max-like protein X

MLX Antibody / Max-like protein X (RQ6889)

  Catalog No Formulation Size Price (USD)  
Image RQ6889 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Flow cytometry testing of human ThP-1 cells with MLX antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= MLX antibody.
Western blot testing of 1) human HepG2, 2) human MCF7, 3) human SiHa, 4) monkey COS-7 and 5) mouse HEPA1-6 cell lysate with MLX antibody. Predicted molecular weight ~33 kDa, commonly observed at 30-50 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Monkey
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9UH92
Applications Western Blot : 1-2ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This MLX antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Max-like protein X is a protein that in humans is encoded by the MLX gene. The product of this gene belongs to the family of basic helix-loop-helix leucine zipper (bHLH-Zip) transcription factors. These factors form heterodimers with Mad proteins and play a role in proliferation, determination and differentiation. This gene product may act to diversify Mad family function by its restricted association with a subset of the Mad family of transcriptional repressors, namely, Mad1 and Mad4. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene.

Application Notes

Optimal dilution of the MLX antibody should be determined by the researcher.

Immunogen

Amino acids FQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY from the human protein were used as the immunogen for the MLX antibody.

Storage

After reconstitution, the MLX antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.