• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> KRIT1 Antibody / CCM1

KRIT1 Antibody / CCM1 (R32542)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32542 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat heart, 2) mouse NIH 3T3 and 3) human HeLa lysate with KRIT1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~84 kDa.
Western blot testing of 1) rat heart, 2) mouse NIH 3T3 and 3) human HeLa lysate with KRIT1 antibody at 0.5ug/ml. Predicted/observed molecular weight: ~84 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O00522
Applications Western blot : 0.5-1ug/ml
Limitations This KRIT1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Krev interaction trapped protein 1 is a protein that in humans is encoded by the CCM1 gene. This gene encodes a protein containing four ankyrin repeats, a band 4.1/ezrin/radixin/moesin (FERM) domain, and multiple NPXY sequences. The encoded protein is localized in the nucleus and cytoplasm. It binds to integrin cytoplasmic domain-associated protein-1 alpha (ICAP1alpha), and plays a critical role in beta1-integrin-mediated cell proliferation. It associates with junction proteins and RAS-related protein 1A (Rap1A), which requires the encoded protein for maintaining the integrity of endothelial junctions. It is also a microtubule-associated protein and may play a role in microtubule targeting. Mutations in this gene result in cerebral cavernous malformations. Multiple alternatively spliced transcript variants have been found for this gene.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the KRIT1 antibody to be titrated for optimal performance.

Immunogen

Amino acids 703-736 (ENKMSFIVHTKQAGLVVKLLMKLNGQLMPTERNS) from the human protein were used as the immunogen for the KRIT1 antibody.

Storage

After reconstitution, the KRIT1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all KRIT1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.