• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Keratocan Antibody

Keratocan Antibody (R31830)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31830 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) mouse testis, 2) mouse skeletal muscle, 3) human MCF7 and 4) human A549 lysate with Keratocan antibody. Predicted molecular weight ~40 kDa but the mature protein can be observed ~52 kDa with possible 34/37 kDa breakdown products. (Ref 1)
Western blot testing of 1) mouse testis, 2) mouse skeletal muscle, 3) human MCF7 and 4) human A549 lysate with Keratocan antibody. Predicted molecular weight ~40 kDa but the mature protein can be observed ~52 kDa with possible 34/37 kDa breakdown products. (Ref 1)
Availability 1-3 business days
Species Reactivity Human, Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt O60938
Applications Western blot : 0.1-0.5ug/ml
Limitations This Keratocan antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Keratocan (KTN), also known as keratan sulfate proteoglycan keratocan, is a protein that in humans is encoded by the KERA gene. It is mapped to 12q22. The protein encoded by this gene is a keratan sulfate proteoglycan that is involved in corneal transparency. Defects in this gene are a cause of autosomal recessive cornea plana 2 (CNA2). Keratan sulfate proteoglycans (KSPGs) are members of the small leucine-rich proteoglycan (SLRP) family. KSPGs, particularly keratocan, lumican and mimecan, are important to the transparency of the cornea.

Application Notes

Optimal dilution of the Keratocan antibody should be determined by the researcher.

Immunogen

Amino acids YLQNNLIETIPEKPFENATQLRWINLNKNKITN of human Keratocan were used as the immunogen for the Keratocan antibody.

Storage

After reconstitution, the Keratocan antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Keratocan antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.