- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
IGF Binding Protein 3 Antibody recognizes insulin-like growth factor-binding protein 3 (IGFBP3), a secreted member of the insulin-like growth factor-binding protein family. IGFBP3 binds insulin-like growth factors with high affinity and helps regulate their transport, stability, and availability for interaction with cell-surface receptors. Historically described as the growth hormone-dependent binding protein, IGFBP3 is an important component of the circulating IGF system and contributes to the regulation of cellular growth, proliferation, differentiation, survival, and metabolism.
IGFBP3 can associate with IGF1 or IGF2 and the acid-labile subunit (IGFALS) to form a circulating ternary complex. Formation of this complex prolongs the half-life of insulin-like growth factors and alters their availability to tissues and receptors. IGFBP3 itself is subject to regulatory mechanisms including proteolysis and post-translational modification. The mature protein contains multiple potential N-linked glycosylation sites, and glycosylated forms commonly migrate at approximately 40-44 kDa, compared with approximately 29 kDa for the nonglycosylated protein.
The historical Growth Hormone-Dependent Binding Protein designation reflects the relationship between growth hormone and circulating IGFBP3. Early biochemical studies identified a growth hormone-dependent IGF-binding protein in human plasma, while subsequent molecular cloning established the relationship of this protein to IGFBP3. Beyond its role in controlling IGF availability, IGFBP3 has also been investigated for IGF-independent effects on proliferation, apoptosis, and other cellular regulatory processes. These functions have made IGFBP3 relevant to research involving growth and development, metabolism, endocrine signaling, and cancer biology.
This rabbit polyclonal antibody provides an additional reagent for investigating IGFBP3 expression and insulin-like growth factor regulation. Its recognition of IGFBP3 supports research into both the classical IGF-binding functions of the protein and its broader roles in cellular regulation. NSJ Bioreagents supplies this antibody for research use in studies of growth factor biology and associated signaling mechanisms. An IGF Binding Protein 3 Antibody can be used to examine IGFBP3 expression in research involving growth, metabolism, and cellular signaling.
For a Protein Microarray Validated monoclonal targeting the same protein with a different clone, see our IGFBP3 Antibody IGFBP3/3424 / BP-53 Antibody page.
Optimal dilution of the IGF Binding Protein 3 Antibody / Growth Hormone-Dependent Binding Protein Antibody should be determined by the researcher.
Amino acids RREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCR of human IGFBP3 were used as the immunogen for the IGF Binding Protein 3 Antibody.
After reconstitution, the IGF Binding Protein 3 Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
IGFBP3 antibody, Insulin-like growth factor-binding protein 3 antibody, IGF-binding protein 3 antibody, IGFBP-3 antibody, Growth hormone-dependent binding protein antibody, BP-53 antibody, IBP-3 antibody, IBP3 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.