- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
IGFBP2 Antibody / Insulin-Like Growth Factor Binding Protein 2 Antibody is used to detect IGFBP2, a secreted member of the insulin-like growth factor binding protein family that regulates the availability and activity of insulin-like growth factors. IGFBP2 is encoded by the IGFBP2 gene and is one of six major high-affinity IGF-binding proteins. Through its interactions with IGF-I and IGF-II, IGFBP2 can influence IGF receptor signaling and processes including cellular proliferation, differentiation, survival and metabolism.
IGFBP2 is a secreted protein containing conserved IGF-binding regions that enable high-affinity association with insulin-like growth factors. By binding IGFs in extracellular environments, IGFBP2 can alter their stability, distribution and accessibility to IGF receptors. Its biological activity is not limited to IGF sequestration, however. IGFBP2 can also participate in IGF-independent mechanisms involving interactions with extracellular matrix components, cell-surface proteins and intracellular signaling pathways. These properties have made IGFBP2 an important target for studies of both canonical IGF signaling and broader mechanisms of cell regulation.
Expression of IGFBP2 varies considerably among tissues and developmental states. The protein has roles in growth and development and has also been investigated in metabolic regulation, tissue remodeling and nervous system biology. Changes in IGFBP2 expression or secretion can modify the extracellular signaling environment and may influence how cells respond to growth-promoting signals. An IGFBP2 Antibody can therefore be useful for examining the abundance and distribution of the protein across experimental tissues and cell models.
IGFBP2 has received particular attention in cancer research. Elevated expression has been reported in multiple tumor types, and IGFBP2 has been studied in relation to tumor growth, invasion, migration and disease progression. Its effects can vary according to cellular context and may involve both IGF-dependent signaling and mechanisms that do not require direct modulation of IGF receptor activity. Because IGFBP2 is secreted, it has also been investigated as a potential circulating biomarker in cancer and other disease settings. Research into these associations continues to clarify whether altered IGFBP2 is a driver of particular biological processes, a consequence of disease-associated signaling changes, or both.
Beyond oncology, IGFBP2 is relevant to research involving glucose and lipid metabolism, insulin sensitivity, aging, bone biology and neurological function. These diverse research areas reflect the broader role of the IGF system in coordinating growth, nutrient availability and cellular responses to physiological conditions. Studying IGFBP2 alongside other components of the IGF signaling network can help define how extracellular IGF regulation contributes to tissue-specific biological responses.
NSJ Bioreagents offers IGFBP2 Antibody reagents for investigating the expression and localization of this IGF-binding protein in biological samples. An Insulin-Like Growth Factor Binding Protein 2 Antibody can support research into IGF signaling, growth regulation, metabolism, cancer biology and other processes associated with IGFBP2 function.
Researchers studying the role of IGFBP2 in cancer can explore our Cancer Marker Antibodies page for additional targets associated with tumor biology and disease progression.
Optimal dilution of the IGFBP2 Antibody / Insulin-Like Growth Factor Binding Protein 2 Antibody should be determined by the researcher.
Amino acids QQELDQVLERISTMRLPDERGPLEHLYSLH of human IGFBP2 were used as the immunogen for the IGFBP2 antibody.
After reconstitution, the IGFBP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
IGFBP2 antibody, Insulin-Like Growth Factor Binding Protein 2 antibody, IGF Binding Protein 2 antibody, IGF-Binding Protein 2 antibody, IBP2 antibody, BP2 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.