• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> GRK6 Antibody

GRK6 Antibody (R32102)

  Catalog No Formulation Size Price (USD)  
Image R32102 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat lung, human 2) HeLa, 3) K562 and 4) Jurkat lysate with GRK6 antibody. Expected/observed molecular weight ~66 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P43250
Applications Western Blot : 0.1-0.5ug/ml
Limitations This GRK6 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

G protein-coupled receptor kinase 6 is an enzyme that in humans is encoded by the GRK6 gene. It is mapped to 5q35. This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. Also, GRK6 appears to be involved in responses tomorphine.

Application Notes

Optimal dilution of the GRK6 antibody should be determined by the researcher.

Immunogen

Amino acids QSPFQQRKKKIKREEVERLVKEVPEEYSERFSPQAR of human GRK6 were used as the immunogen for the GRK6 antibody.

Storage

After reconstitution, the GRK6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.