• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> FZD4 Antibody / Frizzled 4

FZD4 Antibody / Frizzled 4 (RQ4100)

  Catalog No Formulation Size Price (USD)  
Image RQ4100 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) placenta and 2) MCF7 lysate with FZD4 antibody at 0.5ug/ml. Predicted molecular weight ~60 kDa.
IHC testing of FFPE human breast cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE human lung cancer tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE mouse heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
IHC testing of FFPE rat heart tissue with FZD4 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q9ULV1
Localization Cytoplasmic, membrane
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This FZD4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Rat
  • Applications : IHC, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Rat

Description

Frizzled-4 is a protein that in humans is encoded by the FZD4 gene. This gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the Wingless type MMTV integration site family of signaling proteins. Most frizzled receptors are coupled to the beta-catenin canonical signaling pathway. This protein may play a role as a positive regulator of the Wingless type MMTV integration site signaling pathway. A transcript variant retaining intronic sequence and encoding a shorter isoform has been described, however, its expression is not supported by other experimental evidence.

Application Notes

Optimal dilution of the FZD4 antibody should be determined by the researcher.

Immunogen

Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.

Storage

After reconstitution, the FZD4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.