- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
FZD4 Antibody / Wnt Signaling Receptor Antibody (RQ4100)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
|
RQ4100 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 449 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Host | Rabbit |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose |
| UniProt | Q9ULV1 |
| Localization | Cytoplasmic, membrane |
| Applications | Western Blot : 0.5-1ug/ml Immunofluorescence : 5ug/ml |
| Limitations | This FZD4 Antibody / Wnt Signaling Receptor Antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Related Products
|
FZD4 Antibody / Wnt Signaling Receptor Antibody recognizes Frizzled Class Receptor 4 (FZD4), a seven-pass transmembrane receptor that belongs to the Frizzled family of Wnt receptors. FZD4 is a key component of canonical Wnt signaling and is particularly important for vascular development within the retina and central nervous system. Upon binding specific Wnt ligands or the ligand Norrin in conjunction with co-receptors such as LRP5 and TSPAN12, FZD4 activates intracellular signaling pathways that regulate cell proliferation, differentiation, migration and tissue organization. These activities make FZD4 an important target for developmental biology, vascular research and studies of tissue homeostasis. NSJ Bioreagents offers FZD4 antibodies for investigators examining Wnt receptor expression and signaling mechanisms.
FZD4 is expressed in multiple tissues but has especially well-characterized functions in endothelial cells of the retinal vasculature, where it directs blood vessel formation, maturation and maintenance. Genetic variants affecting FZD4 signaling have been linked to inherited retinal vascular disorders, emphasizing the receptor's essential role in ocular development. Beyond the eye, FZD4 contributes to vascular stability, blood-brain barrier function and organ development through tightly regulated Wnt signaling. Altered FZD4 expression or activity has also been investigated in cancer biology, where dysregulated Wnt pathways can influence tumor growth, angiogenesis and metastatic behavior.
Because Wnt signaling regulates stem cell maintenance, embryonic patterning and tissue regeneration, FZD4 has become a valuable research target across numerous biological disciplines. Studies frequently examine receptor localization, downstream beta-catenin activation, ligand responsiveness and interactions with signaling partners. Measuring FZD4 expression can help characterize developmental pathways, evaluate disease-associated signaling changes and investigate therapeutic strategies aimed at modulating Wnt pathway activity. Research involving FZD4 also contributes to understanding endothelial cell biology, vascular remodeling and regenerative medicine.
An FZD4 Antibody is an important tool for detecting this Wnt signaling receptor in applications including Western blotting, immunohistochemistry, immunofluorescence, flow cytometry and related immunoassays. By enabling reliable analysis of receptor expression and distribution, an FZD4 Antibody supports investigations into Wnt signaling, retinal vascular development, angiogenesis and receptor-mediated cell communication.
Researchers studying receptor-mediated Wnt signaling may also be interested in our Signaling Antibodies page, which features antibodies against Frizzled receptors, Wnt ligands, beta-catenin pathway components and other proteins involved in canonical and non-canonical Wnt signaling.
Optimal dilution of the FZD4 Antibody / Wnt Signaling Receptor Antibody should be determined by the researcher.
Amino acids QNLGYNVTKMPNLVGHELQTDAELQLTTFTPLIQY from the human protein were used as the immunogen for the FZD4 antibody.
After reconstitution, the FZD4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
FZD4 antibody, Frizzled 4 antibody, Frizzled Class Receptor 4 antibody, Fz-4 antibody, CD344 antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
