FZD3 Antibody | Wnt Signaling Receptor Antibody

	Catalog No	Formulation	Size	Price (USD)
	RQ4138	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	449
Formulation

FZD3 Antibody SK-OV-3 / Jurkat WB. Western blot analysis of SK-OV-3 and Jurkat cell lysates using FZD3 Antibody demonstrates a prominent immunoreactive band at approximately 76 kDa, consistent with the expected molecular weight of FZD3 (Frizzled 3). FZD3 is a seven-transmembrane Wnt signaling receptor that regulates planar cell polarity, neural development, axon guidance, and tissue morphogenesis. The observed band is consistent with endogenous FZD3 expression and supports the utility of this antibody for western blot detection of Frizzled 3 in human cell lysates.

FZD3 Antibody Breast Cancer IHC. Immunohistochemical staining of FFPE human breast cancer tissue using FZD3 Antibody demonstrates moderate to strong membranous and cytoplasmic staining within malignant epithelial cells. FZD3 is a Wnt signaling receptor that regulates cell polarity, developmental signaling, and tissue morphogenesis, and has been implicated in pathways associated with tumor progression and cellular migration. The observed staining pattern is consistent with FZD3 expression in breast carcinoma cells and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Colon Cancer IHC. Immunohistochemical staining of FFPE human colon cancer tissue using FZD3 Antibody demonstrates moderate membranous and cytoplasmic staining within malignant gland-forming epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor that regulates cell polarity, tissue organization, and developmental signaling pathways frequently dysregulated in colorectal tumorigenesis. The observed staining pattern is consistent with FZD3 expression in colon carcinoma cells and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Mouse Kidney IHC. Immunohistochemical staining of FFPE mouse kidney tissue using FZD3 Antibody demonstrates strong membranous and cytoplasmic staining within renal tubular epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor involved in regulating cell polarity, epithelial organization, and tissue homeostasis through both canonical and non-canonical Wnt signaling pathways. The observed staining pattern is consistent with FZD3 expression in renal tubular structures and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE mouse tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Rat Kidney IHC. Immunohistochemical staining of FFPE rat kidney tissue using FZD3 Antibody demonstrates moderate to strong membranous and cytoplasmic staining within renal tubular epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor that regulates cell polarity, tissue morphogenesis, and epithelial organization through Wnt-mediated signaling pathways. The observed staining pattern is consistent with FZD3 expression in renal tubular structures and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE rat tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

›

FZD3 Antibody SK-OV-3 / Jurkat WB. Western blot analysis of SK-OV-3 and Jurkat cell lysates using FZD3 Antibody demonstrates a prominent immunoreactive band at approximately 76 kDa, consistent with the expected molecular weight of FZD3 (Frizzled 3). FZD3 is a seven-transmembrane Wnt signaling receptor that regulates planar cell polarity, neural development, axon guidance, and tissue morphogenesis. The observed band is consistent with endogenous FZD3 expression and supports the utility of this antibody for western blot detection of Frizzled 3 in human cell lysates.

FZD3 Antibody Breast Cancer IHC. Immunohistochemical staining of FFPE human breast cancer tissue using FZD3 Antibody demonstrates moderate to strong membranous and cytoplasmic staining within malignant epithelial cells. FZD3 is a Wnt signaling receptor that regulates cell polarity, developmental signaling, and tissue morphogenesis, and has been implicated in pathways associated with tumor progression and cellular migration. The observed staining pattern is consistent with FZD3 expression in breast carcinoma cells and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Colon Cancer IHC. Immunohistochemical staining of FFPE human colon cancer tissue using FZD3 Antibody demonstrates moderate membranous and cytoplasmic staining within malignant gland-forming epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor that regulates cell polarity, tissue organization, and developmental signaling pathways frequently dysregulated in colorectal tumorigenesis. The observed staining pattern is consistent with FZD3 expression in colon carcinoma cells and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Mouse Kidney IHC. Immunohistochemical staining of FFPE mouse kidney tissue using FZD3 Antibody demonstrates strong membranous and cytoplasmic staining within renal tubular epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor involved in regulating cell polarity, epithelial organization, and tissue homeostasis through both canonical and non-canonical Wnt signaling pathways. The observed staining pattern is consistent with FZD3 expression in renal tubular structures and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE mouse tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

FZD3 Antibody Rat Kidney IHC. Immunohistochemical staining of FFPE rat kidney tissue using FZD3 Antibody demonstrates moderate to strong membranous and cytoplasmic staining within renal tubular epithelial cells. FZD3 is a Frizzled family Wnt signaling receptor that regulates cell polarity, tissue morphogenesis, and epithelial organization through Wnt-mediated signaling pathways. The observed staining pattern is consistent with FZD3 expression in renal tubular structures and supports the utility of this antibody for immunohistochemical detection of Frizzled 3 in FFPE rat tissues. HIER: steam section in pH6 citrate buffer for 20 minutes and allow to cool prior to testing.

Availability	1-3 business days
Species Reactivity	Human, Mouse, Rat
Format	Antigen affinity purified
Host	Rabbit
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity purified
Buffer	Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt	Q9NPG1
Localization	Membrane, cytoplasm
Applications	Western Blot : 0.5-1ug/ml IHC (FFPE) : 1-2ug/ml
Limitations	This FZD3 Antibody / Wnt Signaling Receptor Antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

FZD3 Antibody / Wnt Signaling Receptor Antibody recognizes FZD3 (Frizzled 3), a member of the Frizzled family of seven-transmembrane receptors that function as key mediators of Wnt signaling pathways. FZD3 is expressed on the cell surface and binds Wnt ligands to initiate intracellular signaling cascades that regulate cellular differentiation, migration, polarity, proliferation, and tissue organization. As part of a highly conserved signaling network, FZD3 plays a fundamental role in coordinating developmental programs and maintaining normal tissue architecture. The receptor is widely studied because Wnt signaling influences numerous biological processes ranging from embryonic development to adult tissue homeostasis.

FZD3 is particularly associated with non-canonical Wnt signaling pathways, including planar cell polarity signaling. These pathways regulate the directional orientation and movement of cells within tissues and are essential for proper morphogenesis. Through its ability to influence cytoskeletal organization and cellular communication, FZD3 helps coordinate complex developmental events that require precise control of cell positioning and polarity. Unlike signaling pathways focused primarily on transcriptional activation, non-canonical Wnt signaling frequently governs dynamic cellular behaviors that shape developing organs and tissues.

Nervous system development represents one of the best-characterized biological functions of FZD3. The receptor contributes to neuronal differentiation, axon guidance, dendritic development, and neural circuit formation. Studies have demonstrated that FZD3 signaling is required for proper establishment of neuronal connections within both the central and peripheral nervous systems. By responding to extracellular guidance cues, FZD3 helps direct growing axons toward their appropriate targets and supports the formation of functional neural networks. These activities have made FZD3 an important research target in developmental neurobiology and neurodevelopmental disease research.

FZD3 expression has been identified in numerous tissues and cell types, reflecting the widespread importance of Wnt signaling throughout the body. In addition to its developmental functions, FZD3 participates in processes involving stem cell regulation, tissue remodeling, cellular communication, and maintenance of tissue integrity. Because Frizzled receptors act as central regulators of signaling pathway activation, changes in receptor expression can significantly influence cellular responses to environmental and developmental signals. This broad biological relevance has established FZD3 as a valuable biomarker for studies examining signal transduction, cellular organization, and developmental biology.

Aberrant Wnt signaling has been implicated in a variety of pathological conditions, including cancer, developmental disorders, and neurodegenerative diseases. Alterations in FZD3 expression or activity may contribute to dysregulated cell growth, migration, and survival signaling. Consequently, FZD3 is frequently investigated in studies exploring disease mechanisms and potential therapeutic targets within the Wnt signaling network. Understanding the role of FZD3 in both normal physiology and disease continues to be an active area of biomedical research.

FZD3 Antibody is useful for investigating Wnt signaling receptor expression, neural development, cell polarity pathways, tissue morphogenesis, and signal transduction mechanisms. These antibodies are commonly used in western blotting, immunohistochemistry, immunofluorescence, and flow cytometry applications to evaluate FZD3 localization and expression in normal and disease-associated tissues.

Explore additional antibodies involved in developmental signaling and Wnt pathway regulation on our Stem Cell Antibodies page.

Application Notes

Optimal dilution of the FZD3 antibody should be determined by the researcher.

Immunogen

Amino acids MPNLLNHYDQQTAALAMEPFHPMVNLDCSRDFRPFL from the human protein were used as the immunogen for the FZD3 antibody.

Storage

After reconstitution, the FZD3 Antibody / Wnt Signaling Receptor Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

FZD3 Antibody, Frizzled 3 Antibody, Frizzled-3 Antibody, Frizzled 3 Receptor Antibody, Wnt Receptor FZD3 Antibody, Frizzled Family Receptor 3 Antibody

Related Products

1. View all FZD3 antibodies

FZD3 Antibody / Wnt Signaling Receptor Antibody (RQ4138)

Description

Application Notes

Immunogen

Storage

Alternate Names

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents