• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> EpCAM Antibody

EpCAM Antibody (R32527)

  Catalog No Formulation Size Price (USD)  
Image R32527 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Immunofluorescent staining of human rectal cancer tissue with EpCAM antibody (red) and DAPI (blue). HIER: steam sections in pH6 citrate buffer for 20 min.
Immunofluorescent staining of human colon tissue with EpCAM antibody (green) and DAPI (blue). HIER: steam sections in pH6 citrate buffer for 20 min.
IHC staining of FFPE human colon cancer tissue with EpCAM antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human colon cancer tissue with EpCAM antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of human 1) Caco-2 and 2) MCF7 cell lysate with EpCAM antibody at 0.5ug/ml. Expected molecualr weight: 35/40-42 kDa.
Flow cytometry testing of fixed human Caco-2 cells with EpCAM antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= EpCAM antibody.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P16422
Localization Cell surface, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Flow Cytometry : 1-3ug/10^6 cells
ELISA : 0.5-1ug/ml (human protein tested)
Limitations This EpCAM antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P
    Reactivity : Human, Mouse, Rat, Dog, Cat
    Microvalidated
  • Applications : FACS, IF, IHC-P
    Reactivity : Human
    Citation  Citations(21)
  • Applications : FACS
    Reactivity : Human. Does not react with rat. Other species not known.
    Citation  Citations(9)
  • Applications : FACS, IF, IHC-P
    Reactivity : Human
    Citation  Citations(9)
  • Applications : WB
    Reactivity : Human
  • Applications : FACS
    Reactivity : Human
    Citation  Citations(9)
  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human
  • Applications : IHC-P
    Reactivity : Human
    Citation  Citations(1)
  • Applications : WB, IHC-P
    Reactivity : Human
    Citation  Citations(6)
  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human
  • Applications : FACS, IF, WB, IHC-P
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : FACS, WB, ELISA
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
    Pred. Reactivity : Bovine, Pig
  • Applications : FACS, WB, ELISA
    Reactivity : Mouse, Human
    Pred. Reactivity : Rat
  • Applications : WB, ELISA
    Reactivity : Mouse
    Pred. Reactivity : Rat
  • Applications : WB, ELISA
    Reactivity : Human, Mouse, Rat

Description

Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell-cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the EpCAM antibody to be titrated for optimal performance.

Immunogen

Amino acids 147-189 (ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENN) from the human protein were used as the immunogen for the EpCAM antibody.

Storage

After reconstitution, the EpCAM antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.