• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Elf-1 Antibody / E74 like factor 1

Elf-1 Antibody / E74 like factor 1 (RQ4212)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4212 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).
Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).
Availability 1-3 business days
Species Reactivity Human
Predicted Reactivity Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P32519
Localization Nuclear, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Limitations This Elf-1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the Elf-1 antibody should be determined by the researcher.

Immunogen

Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.

Storage

After reconstitution, the Elf-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Elf-1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.