• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> E2F4 Antibody

E2F4 Antibody (R32525)

  Catalog No Formulation Size Price (USD)  
Image R32525 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) U-2 OS and 3) MCF7 lysate with E2F4 antibody at 0.5ug/ml. Expected molecular weight ~44 kDa (unmodified) and 60-65 kDa (phosphorylated).
IHC testing of FFPE human intestinal cancer tissue with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE mouse intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
IHC testing of FFPE rat intestine with E2F4 antibody at 1ug/ml. HIER: steam section in pH6 citrate buffer for 20 min.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt Q16254
Localization Cytoplasmic, nuclear
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This E2F4 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : IHC-P
    Reactivity : Human
    Recrabbitmono
  • Applications : IHC-P
    Reactivity : Human
    Recrabbitmono
  • Applications : IHC-P
    Reactivity : Human
    Recrabbitmono
  • Applications : IHC-P
    Reactivity : Human
    Recrabbitmono
  • Applications : IHC-P
    Reactivity : Human
    Microvalidated
  • Applications : WB
    Reactivity : Human, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Dog, Cow
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Mouse, Dog, Pig, Cow

Description

E2F4 is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. This protein binds to all three of the tumor suppressor proteins pRB, p107 and p130, but with higher affinity to the last two.

Application Notes

Differences in protocols and secondary/substrate sensitivity may require the E2F4 antibody to be titrated for optimal performance.

Immunogen

Amino acids 106-144 (ELQQREQELDQHKVWVQQSIRNVTEDVQNSCLAYVTHED) from the human protein were used as the immunogen for the E2F4 antibody.

Storage

After reconstitution, the E2F4 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.