• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> DVL3 Antibody

DVL3 Antibody (R32781)

  Catalog No Formulation Size Price (USD)  
Image R32781 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) rat brain and 2) mouse brain lysate with DVL3 antibody at 0.5ug/ml. Predicted molecular weight ~78 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Predicted Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt Q92997
Applications Western Blot : 0.5-1ug/ml
Limitations This DVL3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.

Application Notes

Optimal dilution of the DVL3 antibody should be determined by the researcher.

Immunogen

Amino acids 397-434 (DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) from the human protein were used as the immunogen for the DVL3 antibody.

Storage

After reconstitution, the DVL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.