- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Segment polarity protein dishevelled homolog DVL-3 is a protein that in humans is encoded by the DVL3 gene. It is mapped to 3q27.1. This gene is a member of a multi-gene family which shares strong similarity with the Drosophila dishevelled gene, dsh. The Drosophila dishevelled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
Optimal dilution of the DVL3 antibody should be determined by the researcher.
Amino acids 397-434 (DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) from the human protein were used as the immunogen for the DVL3 antibody.
After reconstitution, the DVL3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.