• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> DDT Antibody

DDT Antibody (RQ4562)

  Catalog No Formulation Size Price (USD)  
Image RQ4562 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human liver tissue with DDT antibody. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse liver tissue with DDT antibody. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat liver tissue with DDT antibody. HIER: boil tissue sections in pH8 EDTA for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) human liver, 2) rat liver and 3) mouse liver tissue lysate with DDT antibody. Predicted molecular weight ~14 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P30046
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Limitations This DDT antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (protein)
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure. The genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10.

Application Notes

Optimal dilution of the DDT antibody should be determined by the researcher.

Immunogen

Amino acids EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL were used as the immunogen for the DDT antibody.

Storage

After reconstitution, the DDT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.