- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
CEP68 Antibody (RQ4329)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
RQ4329 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 429 |
|
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity purified |
| Buffer | Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide |
| UniProt | Q76N32 |
| Localization | Cytoplasm, cytoskeleton |
| Applications | Western blot : 0.5-1ug/ml |
| Limitations | This CEP68 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.
Optimal dilution of the CEP68 antibody should be determined by the researcher.
Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.
After reconstitution, the CEP68 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz