• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CEP68 Antibody

CEP68 Antibody (RQ4329)

  Catalog No Formulation Size Price (USD)  
Image RQ4329 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO-320, 3) SK-O-V3, 4) Jurkat, 5) rat heart and 6) mouse heart lysate with CEP68 antibody at 0.5ug/ml. Predicted molecular weight ~81 kDa (isoform 1), ~67 kDa (isoform 2).
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt Q76N32
Localization Cytoplasm, cytoskeleton
Applications Western Blot : 0.5-1ug/ml
Limitations This CEP68 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Centrosomal protein of 68 kDa is a protein that in humans is encoded by the CEP68 gene. It is mapped to chromosome 2. CEP68 is required for centrosome cohesion. It decorates fibres emanating from the proximal ends of centrioles. CEP68 and Rootletin depend both on each other for centriole association, and both also require CEP250 for their function.

Application Notes

Optimal dilution of the CEP68 antibody should be determined by the researcher.

Immunogen

Amino acids ELICWLYNVADVTDHGTAARSNLTSLKSSLQLYRQFKKDID were used as the immunogen for the CEP68 antibody.

Storage

After reconstitution, the CEP68 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.