CD36 Polyclonal Antibody | Fatty Acid Translocase

	Catalog No	Formulation	Size	Price (USD)
	R31985	0.5mg/ml if reconstituted with 0.2ml sterile DI water	100 ug	449
Formulation

CD36 Polyclonal Antibody WB Analysis of Human, Mouse and Rat Samples. Western blot analysis using CD36 Antibody with rat liver (lane 1), rat heart (lane 2), mouse liver (lane 3), mouse heart (lane 4), and human SMCC cell lysates (lane 5). An immunoreactive band is detected near 88 kDa in all five samples, consistent with the expected migration of heavily glycosylated CD36. The predicted molecular weight of the unglycosylated protein is approximately 53 kDa.

CD36 Polyclonal Antibody IHC Staining of Rat Spleen Tissue. Immunohistochemical analysis of FFPE rat spleen tissue using CD36 Antibody. Brown DAB staining is observed in scattered cells and cellular clusters throughout the section, with heterogeneous distribution against the hematoxylin counterstain. Heat-induced epitope retrieval was performed by boiling tissue sections in 10 mM citrate buffer (pH 6) for 20 minutes, followed by cooling before staining.

CD36 Polyclonal Antibody IHC Staining of Human Lung Cancer Tissue. Immunohistochemical analysis of FFPE human lung cancer tissue using CD36 Antibody. Brown DAB staining is observed in scattered cells within the tumor-associated tissue, with variable staining intensity and distribution. Hematoxylin counterstaining highlights the surrounding tissue architecture. Heat-induced epitope retrieval was performed by boiling tissue sections in 10 mM citrate buffer (pH 6) for 20 minutes, followed by cooling before staining.

›

CD36 Polyclonal Antibody WB Analysis of Human, Mouse and Rat Samples. Western blot analysis using CD36 Antibody with rat liver (lane 1), rat heart (lane 2), mouse liver (lane 3), mouse heart (lane 4), and human SMCC cell lysates (lane 5). An immunoreactive band is detected near 88 kDa in all five samples, consistent with the expected migration of heavily glycosylated CD36. The predicted molecular weight of the unglycosylated protein is approximately 53 kDa.

CD36 Polyclonal Antibody IHC Staining of Rat Spleen Tissue. Immunohistochemical analysis of FFPE rat spleen tissue using CD36 Antibody. Brown DAB staining is observed in scattered cells and cellular clusters throughout the section, with heterogeneous distribution against the hematoxylin counterstain. Heat-induced epitope retrieval was performed by boiling tissue sections in 10 mM citrate buffer (pH 6) for 20 minutes, followed by cooling before staining.

CD36 Polyclonal Antibody IHC Staining of Human Lung Cancer Tissue. Immunohistochemical analysis of FFPE human lung cancer tissue using CD36 Antibody. Brown DAB staining is observed in scattered cells within the tumor-associated tissue, with variable staining intensity and distribution. Hematoxylin counterstaining highlights the surrounding tissue architecture. Heat-induced epitope retrieval was performed by boiling tissue sections in 10 mM citrate buffer (pH 6) for 20 minutes, followed by cooling before staining.

Availability	1-3 business days
Species Reactivity	Human, Mouse, Rat
Format	Antigen affinity purified
Host	Rabbit
Clonality	Polyclonal (rabbit origin)
Isotype	Rabbit IgG
Purity	Antigen affinity
Buffer	Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt	P16671
Localization	Cell membrane
Applications	Western blot: 0.1-0.5ug/ml Immunohistochemistry (FFPE): 0.5-1ug/ml
Limitations	This CD36 Polyclonal Antibody / CD36 Antibody is available for research use only.
	Review this product on BioCompare and get a $20 Amazon gift card

Description

CD36 Polyclonal Antibody / CD36 Antibody targets CD36, a multifunctional membrane glycoprotein involved in fatty acid transport, scavenger receptor activity, and cellular signaling. Also known as fatty acid translocase (FAT), platelet glycoprotein IV (GPIV), and scavenger receptor class B member 3 (SCARB3), CD36 belongs to the class B scavenger receptor family. Its ability to recognize diverse extracellular ligands connects lipid metabolism with innate immunity, vascular biology, and cellular responses to metabolic stress.

CD36 facilitates the uptake of long-chain fatty acids and contributes to their utilization for energy production, membrane synthesis, and lipid storage. It is particularly important in metabolically active tissues, including cardiac and skeletal muscle. CD36 abundance at the plasma membrane is dynamically regulated through intracellular trafficking, allowing cells to adjust fatty acid uptake in response to changing energy requirements. Insulin signaling and muscle contraction can promote the redistribution of CD36 from intracellular compartments to the cell surface.

Beyond lipid transport, CD36 functions as a pattern recognition receptor that binds oxidized low-density lipoproteins, thrombospondin-1, and selected microbial or damage-associated ligands. In macrophages, CD36-mediated uptake of oxidized lipoproteins contributes to foam cell formation during atherosclerosis. Interactions with other membrane receptors and signaling proteins influence inflammatory responses, phagocytosis, and the clearance of cellular debris. These activities establish an important connection between lipid metabolism and immune regulation.

CD36 contains two membrane-spanning regions separated by a large extracellular domain. Extensive N-linked glycosylation contributes to its maturation, stability, and trafficking. Consequently, mature CD36 commonly migrates at approximately 80-90 kDa, substantially above the molecular weight predicted from its amino acid sequence. Other post-translational modifications, including palmitoylation, can influence receptor localization and function.

CD36 expression has also attracted attention in cancer research because increased fatty acid uptake can support metabolic adaptation, tumor growth, and metastatic behavior in certain cellular contexts. Its contributions depend on tissue environment, receptor abundance, and available lipid substrates. CD36 Polyclonal Antibody supports investigations into receptor expression and its relationship to lipid metabolism, inflammatory signaling, and disease-associated cellular changes. Understanding CD36 regulation may help clarify mechanisms underlying cardiovascular disease, metabolic disorders, and cancer.

Visit our CD36 Antibody page to discover additional antibodies against this Fatty Acid Translocase and multifunctional scavenger receptor involved in fatty acid uptake, cardiovascular biology, and cancer metabolism.

Application Notes

Optimal dilution of the CD36 Polyclonal Antibody / CD36 Antibody should be determined by the researcher.

Immunogen

Amino acids DLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFW of human CD36 were used as the immunogen for the CD36 Polyclonal Antibody.

Storage

After reconstitution, the CD36 Polyclonal Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

Fatty acid translocase antibody, Platelet glycoprotein IV antibody, Platelet glycoprotein 4 antibody, Glycoprotein IIIb antibody, Glycoprotein IV antibody, Scavenger receptor class B member 3 antibody, Thrombospondin receptor antibody, FAT/CD36 antibody, GPIV antibody, GPIIIb antibody, SCARB3 antibody

Related Products

1. View all CD36 antibodies

CD36 Polyclonal Antibody / CD36 Antibody (R31985)

Description

Application Notes

Immunogen

Storage

Alternate Names

Related Products

Area of Research

Product Type

Protocols

Contact Us

NSJ Bioreagents