• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CD1b Antibody

CD1b Antibody (RQ4547)

  Catalog No Formulation Size Price (USD)  
Image RQ4547 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human tonsil tissue with CD1b antibody at 1ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of human 1) placenta, 2) PC-3, 3) SW620, 4) THP-1, 5) MDA-MB-231, 6) K562 and 7) A431 lysate with CD1b antibody at 0.5ug/ml. The predicted molecular weight is ~37 kDa but is often observed higher due to glycosylation.
Availability 1-3 business days
Species Reactivity Human
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P29016
Localization Plasma membrane, cytoplasm
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This CD1b antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : ELISA, FACS, IF
    Reactivity : Human
  • Applications : FACS, IF, Functional studies
    Reactivity : Human
  • Applications : WB, ELISA
    Reactivity : Human
  • Applications : WB, Direct ELISA
    Reactivity : Human, Mouse, Rat

Description

CD1b is a member of the CD1 family of transmembrane glycoproteins, which are structurally related to the major histocompatibility complex (MHC) proteins and form heterodimers with beta-2-microglobulin. The CD1 proteins mediate the presentation of primarily lipid and glycolipid antigens of self or microbial origin to T cells. The human genome contains five CD1 family genes organized in a cluster on chromosome 1. The CD1 family members are thought to differ in their cellular localization and specificity for particular lipid ligands. The protein encoded by this gene localizes to late endosomes and lysosomes via a tyrosine-based motif in the cytoplasmic tail, and requires vesicular acidification to bind lipid antigens.

Application Notes

Optimal dilution of the CD1b antibody should be determined by the researcher.

Immunogen

Amino acids DKEVAELEEIFRVYIFGFAREVQDFAGDFQMKY were used as the immunogen for the CD1b antibody.

Storage

After reconstitution, the CD1b antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.