• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> CCT3 Antibody

CCT3 Antibody [clone 12H4] (RQ4525)

  Catalog No Formulation Size Price (USD)  
Image RQ4525 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of human 1) HeLa, 2) MCF7, 3) COLO-320, 4) HepG2 and 5) HT-1080 cell lysate with CCT3 antibody at 0.5ug/ml. Predicted molecular weight ~61 kDa.
Availability 1-3 business days
Species Reactivity Human
Format Purified
Clonality Monoclonal (mouse origin)
Isotype Mouse IgG1
Clone Name 12H4
Purity Protein G affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P49368
Localization Cytoplasm
Applications Western Blot : 0.5-1ug/ml
Limitations This CCT3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

T-complex protein 1 subunit gamma is a protein that in humans is encoded by the CCT3 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants have been characterized for this gene. In addition, a pseudogene of this gene has been found on chromosome 8.

Application Notes

Optimal dilution of the CCT3 antibody should be determined by the researcher.

Immunogen

Amino acids EPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQ were used as the immunogen for the CCT3 antibody.

Storage

After reconstitution, the CCT3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.