- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Carboxypeptidase A1 is an enzyme that in humans is encoded by the CPA1 gene. This gene encodes a member of the carboxypeptidase A family of zinc metalloproteases. This enzyme is produced in the pancreas and preferentially cleaves C-terminal branched-chain and aromatic amino acids from dietary proteins. This gene and several family members are present in a gene cluster on chromosome 7. Mutations in this gene may be linked to chronic pancreatitis, while elevated protein levels may be associated with pancreatic cancer.
For additional tissue-specific detection and characterization of CPA1 expression as a pancreatic acinar cell marker, see our Carboxypeptidase A1 antibody clone CPA1/8163R featuring validated IHC and western blot data.
Optimal dilution of the Carboxypeptidase A antibody should be determined by the researcher.
Amino acids KRPAIWIDTGIHSREWVTQASGVWFAKKITQDYGQDAAFTAILDTLD from the human protein were used as the immunogen for the Carboxypeptidase A antibody.
After reconstitution, the Carboxypeptidase A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.