• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> BMP2 Antibody

BMP2 Antibody (R31949)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31949 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.
›
Western blot testing of 1) rat brain, 2) rat lung, 3) human U87, 4) human HeLa lysate with BMP2 antibody. Expected molecular weight: 13-14 kDa per monomer.
IHC testing of FFPE human intestinal cancer tissue with BMP2 antibody. HIER: Boil the paraffin sections in pH 6, 10mM citrate buffer for 20 minutes and allow to cool prior to staining.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P12643
Localization Cytoplasmic
Applications Western blot : 0.1-0.5ug/ml
IHC (FFPE) : 0.5-1ug/ml
ELISA : 0.1-0.5ug/ml (human protein tested); request BSA-free format for coating
Limitations This BMP2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

BMP2 is also known as Bone morphogenetic protein 2 or BMP2A. It is mapped to 20p12. The protein encoded by this gene belongs to the transforming growth factor-beta (TGFB) superfamily.BMP-2, like otherbone morphogenetic proteins,plays an important role in the development of bone and cartilage. It is involved in thehedgehog pathway,TGF beta signaling pathway, and incytokine-cytokine receptor interaction. Also, it is involved in cardiac cell differentiation andepithelial to mesenchymal transition. In addition, BMP2A has been suggested as a reasonable candidate for the human condition fibrodysplasia (myositis) ossificans progressiva, on the basis of observations in a Drosophila model.

Application Notes

Optimal dilution of the BMP2 antibody should be determined by the researcher.

Immunogen

Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.

Storage

After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all BMP2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.