- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
BMP2 Antibody / Osteogenic Growth Factor Antibody recognizes Bone Morphogenetic Protein 2 (BMP2), a secreted signaling molecule belonging to the transforming growth factor-beta (TGF-beta) superfamily. BMP2 functions as a potent developmental growth factor that regulates embryonic patterning, skeletal formation, tissue differentiation, and organ development. Through activation of BMP signaling pathways, BMP2 influences cellular proliferation, lineage commitment, and morphogenetic processes required for normal vertebrate development. BMP2 is one of the most extensively studied members of the BMP family due to its central role in osteogenesis and bone formation.
BMP2 is a critical regulator of skeletal development and promotes differentiation of mesenchymal stem cells into osteoblasts. Through these activities, BMP2 contributes to bone growth, remodeling, fracture repair, and maintenance of skeletal integrity. The protein has attracted considerable interest in developmental biology, regenerative medicine, and orthopedic research because of its ability to stimulate bone formation and tissue regeneration. Researchers frequently evaluate BMP2 expression when investigating osteogenesis, skeletal disorders, and regenerative processes.
Beyond its role in bone biology, BMP2 participates in numerous developmental signaling pathways that regulate formation of the cardiovascular system, nervous system, and other organ systems. BMP2-mediated signaling influences cell fate determination, tissue patterning, and morphogenesis throughout embryonic development. Altered BMP2 expression or signaling activity has been associated with developmental abnormalities, impaired tissue regeneration, and disease-related changes in cellular differentiation pathways. Consequently, BMP2 remains an important target in studies focused on developmental regulation and tissue homeostasis.
BMP2 signaling occurs through interactions with BMP receptors that activate intracellular SMAD-dependent and SMAD-independent pathways. These signaling networks coordinate transcriptional programs that govern growth, differentiation, and tissue remodeling. Because BMP2 occupies a central position within developmental and regenerative signaling cascades, it is widely used as a marker of osteogenic activity and growth factor-mediated tissue development. Continued investigation of BMP2 has expanded our understanding of the molecular mechanisms that control tissue formation and repair.
At NSJ Bioreagents, we provide highly validated antibodies for developmental biology, stem cell research, regenerative medicine, and cell signaling studies. BMP2 Antibody / Osteogenic Growth Factor Antibody is useful for investigating skeletal development, osteogenesis, tissue regeneration, developmental signaling, and morphogenetic processes. Ongoing research continues to reveal new roles for BMP2 in vertebrate development, tissue repair, and maintenance of physiological homeostasis.
Explore additional antibodies involved in cellular differentiation, developmental signaling, and tissue morphogenesis on our Cell Biology Antibodies page.
Optimal dilution of the BMP2 Antibody / Osteogenic Growth Factor Antibody should be determined by the researcher.
Amino acids QAKHKQRKRLKSSCKRHPLYVDFSDVGWND of human BMP2 were used as the immunogen for the BMP2 antibody.
After reconstitution, the BMP2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Bone Morphogenetic Protein 2 Antibody, Osteogenic Growth Factor Antibody, BMP-2 Antibody, TGF-Beta Superfamily Growth Factor Antibody, Bone Formation Protein Antibody, Skeletal Development Growth Factor Antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.