- Tel: 858.663.9055
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
ATP2A3 Antibody (R30157)
Email: info@nsjbio.com
| Catalog No | Formulation | Size | Price (USD) | ||
|---|---|---|---|---|---|
 |
R30157 | 0.5mg/ml if reconstituted with 0.2ml sterile DI water | 100 ug | 439 |
| Availability | 1-3 business days |
| Species Reactivity | Human, Mouse, Rat |
| Format | Antigen affinity purified |
| Clonality | Polyclonal (rabbit origin) |
| Isotype | Rabbit IgG |
| Purity | Antigen affinity |
| Buffer | Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide |
| Gene ID | 489 |
| Applications | Western blot : 0.5-1ug/ml IHC (FFPE) : 0.5-1ug/ml |
| Limitations | This ATP2A3 antibody is available for research use only. |
|
Review this product on BioCompare and get a $20 Amazon gift card
|
Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. WhatÂ’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.
The stated application concentrations are suggested starting amounts. Titration of the ATP2A3 antibody may be required due to differences in protocols and secondary/substrate sensitivity.
An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody.
After reconstitution, the ATP2A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.
Powered by Bioz
