• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ATF6 Antibody

ATF6 Antibody (R32695)

  Catalog No Formulation Size Price (USD)  
Image R32695 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
IHC testing of FFPE human breast cancer tissue with ATF6 antibody at 1ug/ml. Required HIER: steam section in pH6 citrate buffer for 20 min and allow to cool prior to testing.
Western blot testing of 1) rat liver, 2) mouse liver and 3) human MCF7 cell lysate with ATF6 antibody at 0.5ug/ml. Predicted molecular weight ~75 kDa, rountinely observed at 90-100 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P18850
Applications Western Blot : 0.5-1ug/ml
IHC (FFPE) : 1-2ug/ml
Limitations This ATF6 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

ATF6, a member of the leucine zipper protein family, is an endoplasmic reticulum (ER) stress-regulated transmembrane transcription factor that activates the transcription of ER molecules. This gene is mapped to chromosome 1q23.3. ATF6 can constitutively induce the promoter of glucose-regulated protein (grp) genes through activation of the endoplasmic reticulum (ER) stress element (ERSE).

Application Notes

Optimal dilution of the ATF6 antibody should be determined by the researcher.

Immunogen

Amino acids 597-629 (AININENVINGQDYEVMMQIDCQVMDTRILHIK) from the human protein were used as the immunogen for the ATF6 antibody.

Storage

After reconstitution, the ATF6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.