• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> 5HT2AR Antibody / Serotonin Receptor Antibody

5HT2AR Antibody / Serotonin Receptor Antibody (R32043)

  Catalog No Formulation Size Price (USD)  
Image R32043 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
5HT2AR Antibody Human Brain IHC. Immunohistochemical staining of FFPE human brain tissue using 5HT2AR Antibody at 2 ug/ml. HIER was performed in pH 8.0 EDTA buffer. An HRP-conjugated goat anti-rabbit IgG secondary antibody with DAB substrate was used for detection. 5HT2AR Antibody, a Serotonin Receptor Antibody, demonstrates selective staining of neuronal processes and vascular-associated structures within the brain, consistent with the expected distribution of HTR2A in neural tissue.
5HT2AR Antibody Human Glioma IHC. Immunohistochemical staining of FFPE human glioma tissue using 5HT2AR Antibody at 1 ug/ml. HIER was performed in pH 6 citrate buffer. An HRP-conjugated secondary antibody with DAB substrate was used for detection. 5HT2AR Antibody, a Serotonin Receptor Antibody, demonstrates predominantly cytoplasmic staining in glioma cells with minimal background staining in the surrounding tissue.
5HT2AR Antibody Rat Brain IHC. Immunohistochemical staining of FFPE rat brain tissue using 5HT2AR Antibody at 1 ug/ml. HIER was performed in pH 6 citrate buffer. An HRP-conjugated secondary antibody with DAB substrate was used for detection. 5HT2AR Antibody, a Serotonin Receptor Antibody, demonstrates strong cytoplasmic staining of neurons with minimal staining of the surrounding neuropil, consistent with the expected neuronal expression pattern of HTR2A.
5HT2AR Antibody Human and Rat WB. Western blot analysis of rat brain and testis lysates, and human U-87 MG cell lysate using 5HT2AR Antibody. An HRP-conjugated secondary antibody with ECL substrate was used for detection. 5HT2AR Antibody, a Serotonin Receptor Antibody, detects a prominent band at approximately 53 kDa in both rat tissues and human cells, consistent with the predicted molecular weight of HTR2A.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Host Rabbit
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt P28223
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 1-2ug/ml
Limitations This 5HT2AR Antibody / Serotonin Receptor Antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

5HT2AR Antibody recognizes 5-hydroxytryptamine receptor 2A (HTR2A), one of the best-characterized serotonin receptors and a member of the class A G protein-coupled receptor (GPCR) family. Primarily coupled to Gq/11 proteins, 5HT2AR activates phospholipase C, leading to inositol triphosphate and diacylglycerol production, intracellular calcium mobilization, and protein kinase C activation. These signaling events regulate neuronal excitability, neurotransmitter release, synaptic plasticity, and activity-dependent gene expression. Because of its fundamental role in serotonergic neurotransmission, 5HT2AR Antibody is widely used to investigate receptor biology, GPCR signaling, and nervous system function.

5HT2AR is highly expressed throughout the cerebral cortex, particularly within pyramidal neurons of the prefrontal cortex, as well as in the hippocampus, amygdala, basal ganglia, thalamus, and other regions involved in cognition, learning, memory, mood, and sensory processing. Outside the central nervous system, HTR2A is also expressed in platelets, vascular smooth muscle, gastrointestinal tissues, fibroblasts, and selected immune cell populations, where it contributes to vascular contraction, platelet aggregation, gastrointestinal motility, and inflammatory signaling. As a Serotonin Receptor Antibody, 5HT2AR Antibody is valuable for investigating receptor localization, signal transduction, receptor trafficking, and serotonin-mediated cellular responses across multiple organ systems.

Altered HTR2A expression or activity has been associated with numerous neurological and psychiatric disorders, including schizophrenia, major depressive disorder, anxiety disorders, bipolar disorder, autism spectrum disorders, migraine, Alzheimer's disease, and Parkinson's disease. The receptor is also the principal molecular target of many atypical antipsychotic medications and serotonergic psychedelic compounds, including LSD, psilocybin, and mescaline, making 5HT2AR one of the most extensively studied GPCRs in neuroscience and neuropharmacology. Consequently, HTR2A has become an important biomarker for studies of neuronal signaling, psychiatric disease mechanisms, and therapeutic drug development.

Beyond neurotransmission, 5HT2AR influences cellular proliferation, differentiation, cytoskeletal organization, and communication between neurons and glial cells. Increasing evidence also supports roles for HTR2A in neuroinflammation, cardiovascular physiology, metabolic regulation, and cancer biology, expanding interest in this receptor beyond traditional neuroscience research. These diverse biological functions continue to drive investigations into 5HT2AR as both a disease biomarker and a therapeutic target across multiple disciplines.

5HT2AR Antibody, a Serotonin Receptor Antibody, provides a valuable research tool for investigating serotonin receptor expression, GPCR signaling, and receptor pharmacology. Researchers use 5HT2AR Antibody to study neurotransmission, synaptic plasticity, psychiatric disorders, neurodegenerative disease, cardiovascular physiology, and the molecular mechanisms underlying serotonergic therapeutics and psychedelic drug action.

Explore additional GPCR Antibodies for receptors involved in neurotransmission, G protein-coupled signaling, sensory perception, and cellular communication.

Application Notes

Optimal dilution of the 5HT2AR antibody should be determined by the researcher.

Immunogen

Amino acids KENKKPLQLILVNTIPALAYKSSQLQMGQKKN of human 5HT2A Receptor were used as the immunogen for the 5HT2AR antibody.

Storage

After reconstitution, the 5HT2AR Antibody / Serotonin Receptor Antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Alternate Names

HTR2A Antibody, 5-Hydroxytryptamine Receptor 2A Antibody, Serotonin 2A Receptor Antibody, 5-HT2A Receptor Antibody, 5HT2A Antibody, CD Antibody

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.