• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> 14-3-3 zeta/delta Antibody / YWHAZ

14-3-3 zeta/delta Antibody / YWHAZ [clone 6H7] (RQ5643)

  Catalog No Formulation Size Price (USD)  
Image RQ5643 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 449
Bulk quote request
Western blot testing of 1) human HeLa, 2) human A549, 3) monkey COS-7, 4) human Raji, 5) human Caco-2, 6) human Jurkat, 7) mouse brain and 8) rat brain lysate with 14-3-3 zeta/delta antibody. Predicted molecular weight ~28 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat, Monkey
Format Antigen affinity purified
Host Mouse
Clonality Monoclonal
Isotype Mouse IgG1
Clone Name 6H7
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P63104
Applications Western Blot : 0.5-1ug/ml
Limitations This 14-3-3 zeta/delta antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

Application Notes

Optimal dilution of the 14-3-3 zeta/delta antibody should be determined by the researcher.

Immunogen

Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the 14-3-3 zeta/delta antibody.

Storage

After reconstitution, the 14-3-3 zeta/delta antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.