• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> SP1 Antibody / Specific Protein 1

SP1 Antibody / Specific Protein 1 (R31910)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31910 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) human HeLa, 2) human Caco-2, 3) human Jurkat, 4) human COLO-320 and 5) rat testis tissue lysate with SP1 antibody. Expected molecular weight: 81-95 kDa.
Western blot testing of 1) human HeLa, 2) human Caco-2, 3) human Jurkat, 4) human COLO-320 and 5) rat testis tissue lysate with SP1 antibody. Expected molecular weight: 81-95 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P08047
Applications Western blot : 0.1-0.5ug/ml
Limitations This SP1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

SP1 (transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.

Application Notes

Optimal dilution of the SP1 antibody should be determined by the researcher.

Immunogen

Amino acids EAICPEGIARLANSGINVMQVADLQSINISGNGF of human SP1 were used as the immunogen for the SP1 antibody.

Storage

After reconstitution, the SP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all SP1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.