• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Mmp-12 Antibody

Mmp-12 Antibody (R32074)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32074 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of mouse HEPA lysate with Mmp-12 antibody. Predicted molecular weight: ~55 kDa (pro form), ~45 kDa and ~22 kDa (active forms).
Western blot testing of mouse HEPA lysate with Mmp-12 antibody. Predicted molecular weight: ~55 kDa (pro form), ~45 kDa and ~22 kDa (active forms).
Availability 1-3 business days
Species Reactivity Mouse
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P34960
Applications Western blot : 0.1-0.5ug/ml
ELISA : 0.1-0.5ug/ml (mouse protein tested); request BSA-free format for coating
Limitations This Mmp-12 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P
    Reactivity : Human
    Recrabbitmono
  • Applications : WB
    Reactivity : Human
  • Applications : WB, ELISA (peptide)
    Reactivity : Human
    Pred. Reactivity : Dog, Cow
  • Applications : WB, IHC-P, IF
    Reactivity : Human, Mouse

Description

Matrix metalloproteinase-12 (MMP12), also known as MME or ME, is an enzyme that in humans is encoded by the MMP12 gene. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.2. It is thought that the protein encoded by this gene is cleaved at both ends to yield the active enzyme, but this processing has not been fully described. The enzyme degrades soluble and insoluble elastin. It may play a role in aneurysm formation and studies in mice suggest a role in the development of emphysema. This gene may involved in tissue injury and remodeling.

Application Notes

Optimal dilution of the Mmp-12 antibody should be determined by the researcher.

Immunogen

Amino acids KIDAVLYFKRHYYIFQGAYQLEYDPLFRRVTKTLK of mouse Mmp-12 were used as the immunogen for the Mmp-12 antibody.

Storage

After reconstitution, the Mmp-12 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all MMP12 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.