• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> Elf-1 Antibody / E74 like factor 1

Elf-1 Antibody / E74 like factor 1 (RQ4212)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4212 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).
Western blot testing of human 1) HeLa, 2) COLO320, 3) A549, 4) PANC-1, 5) A431, 6) Jurkat and 7) 293T cell lysate with Elf-1 antibody at 0.5ug/ml. Expected molecular weight: ~68 kDa (unmodified) up to ~80 kDa (phosphorylated/glycosylated cytoplasmic form) and up to ~98 kDa (phosphorylated/glycosylated nuclear form).
Availability 1-3 business days
Species Reactivity Human
Predicted Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P32519
Localization Nuclear, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Limitations This Elf-1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

E74-like factor 1 (ets domain transcription factor) is a protein that in humans is encoded by the ELF1 gene. It is mapped to chromosome 13q13. This gene encodes an E26 transformation-specific related transcription factor. The encoded protein is primarily expressed in lymphoid cells and acts as both an enhancer and a repressor to regulate transcription of various genes. Alternative splicing results in multiple transcript variants.

Application Notes

Optimal dilution of the Elf-1 antibody should be determined by the researcher.

Immunogen

Amino acids QPTQSPYPTQLFRTVHVVQPVQAVPEGEAARTSTMQDE were used as the immunogen for the Elf-1 antibody.

Storage

After reconstitution, the Elf-1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Elf-1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.