• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> DDT Antibody

DDT Antibody (RQ4562)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4562 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
IHC staining of FFPE human ovarian cancer with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
›
IHC staining of FFPE human ovarian cancer with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human intestinal cancer with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human cholangiocarcinoma with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human tonsil with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE human placenta with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse small intestine with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE mouse spleen with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
IHC staining of FFPE rat spleen with DDT antibody at 2ug/ml. HIER: boil tissue sections in pH6, 10mM citrate buffer, for 10-20 min followed by cooling at RT for 20 min.
Western blot testing of 1) human HL-60, 2) rat liver and 3) mouse liver lysate with DDT antibody at 0.5ug/ml. Predicted molecular weight ~14 kDa.
Immunofluorescent staining of FFPE human U-2 OS cells with DDT antibody (red) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human U-2 OS cells with DDT antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= DDT antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P30046
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Immunohistochemistry (FFPE) : 2-3ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This DDT antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, IHC-P, ELISA (protein)
    Reactivity : Human, Mouse, Rat
  • Applications : WB, IHC-P
    Reactivity : Human, Mouse, Rat

Description

DDT, D-dopachrome tautomerization, converts D-dopachrome into 5, 6-dihydroxyindole. Northern blot analysis revealed that DDT was expressed as a 0.6-kb mRNA in all tissues tested, with the strongest expression in liver. The DDT gene in human and mouse is identical in exon structure to the MIF gene. Both genes have 2 introns that are located at equivalent positions, relative to a 2-fold repeat in protein structure.the genes for DDT and MIF are closely linked on human chromosome 22 and mouse chromosome 10.

Application Notes

Optimal dilution of the DDT antibody should be determined by the researcher.

Immunogen

Amino acids EFLTKELALGQDRILIRFFPLESWQIGKIGTVMTFL were used as the immunogen for the DDT antibody.

Storage

After reconstitution, the DDT antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all DDT antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.