• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> ATP2A3 Antibody

ATP2A3 Antibody (R30157)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R30157 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of ATP2A3 antibody and Lane 1: rat skeletal muscle; 2: mouse skeletal muscle; Predicted size: 114KD; Observed size: 114KD
›
Western blot testing of ATP2A3 antibody and Lane 1: rat skeletal muscle; 2: mouse skeletal muscle; Predicted size: 114KD; Observed size: 114KD
IHC-P: ATP2A3 antibody testing of mouse thymus tissue
IHC-P: ATP2A3 antibody testing of rat thymus tissue
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
Gene ID 489
Applications Western blot : 0.5-1ug/ml
IHC (FFPE) : 0.5-1ug/ml
Limitations This ATP2A3 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Sarcoplasmic/endoplasmic reticulum calcium ATPase 3, also known as SERCA3, is anenzyme that in humans is encoded by the ATP2A3 gene. It is mapped to 17p13.2. This gene encodes one of the SERCA Ca2+-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of cells. ATP2A3 expression was originally described as non-muscular, but was recently observed in cardiomyocyte. WhatÂ’s more, the expression of ATP2A3 was significantly reduced or lost in colon carcinomas compared with normal colonic epithelial cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to the sarcoplasmic reticulum lumen, and is involved in calcium sequestration associated with muscular excitation and contraction.

Application Notes

The stated application concentrations are suggested starting amounts. Titration of the ATP2A3 antibody may be required due to differences in protocols and secondary/substrate sensitivity.

Immunogen

An amino acid sequence from the N-terminus of human ATP2A3 (MEAAHLLPAADVLRHFSVTAEGGLSPAQVT) was used as the immunogen for this ATP2A3 antibody.

Storage

After reconstitution, the ATP2A3 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all ATP2A3 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.