• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> ZP1 Antibody

ZP1 Antibody (R32398)

  Catalog No Formulation Size Price (USD)  
Image R32398 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 329
Western blot testing of 1) rat ovary and 2) human SKOV lysate with ZP1 antibody. Expected molecular weight: 70/90-110 kDa (unmodified/glycosylated).
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P60852
Applications Western blot : 0.1-0.5ug/ml
Limitations This ZP1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Zona pellucida sperm-binding protein 1 is a protein that belopngs to the mammalian zona pellucida. The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. Zp1 ensures the structural integrity of the zona pellucida. Mutations in this gene are a cause of oocyte maturation defect and infertility. And this gene is mapped to chromosome 11q12.2.

Application Notes

Optimal dilution of the ZP1 antibody should be determined by the researcher.

Immunogen

Amino acids HVLEKDGRFHLRVFMEAVLPNGRVDVAQDATLICPKPD were used as the immunogen for the ZP1 antibody.

Storage

After reconstitution, the ZP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.