• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Zonula occludens protein 2 Antibody / ZO-2 / TJP2

Zonula occludens protein 2 Antibody / ZO-2 / TJP2 (RQ6808)

  Catalog No Formulation Size Price (USD)  
Image RQ6808 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Immunofluorescent staining of FFPE human A431 cells with Zonula occludens protein 2 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
IHC staining of FFPE human liver cancer tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE infiltrating adenocarcinoma of the lung tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE squamous metaplasia of the renal pelvis tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE papillary carcinoma of the left breast tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human bladder cancer tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE human ovarian serous adenocarcinoma tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE differentiated adenocarcinoma of the rectum tissue with Zonula occludens protein 2 antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Western blot testing of 1) human HeLa, 2) human MCF7, 3) monkey COS-7 and 4) rat PC-12 cell lysate with Zonula occludens protein 2 antibody. Expected molecular weight: 131-160 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat, Monkey
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q9UDY2
Localization Cytoplasmic, nuclear, cell junctions
Applications Western Blot : 1-2ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence (FFPE) : 5ug/ml
Limitations This Zonula occludens protein 2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

TJP2 (Tight Junction Protein 2), also known as Zona Occludens 2 or ZO2 is a protein that in humans is encoded by the TJP2 gene. Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. Duclos et al.(1994) mapped the TJP2 gene telomeric to the Friedreich ataxia critical region on chromosome 9q13-q21. TJP2 lies about 70 kb centromeric to the X123 gene and is transcribed in the centromere-to-telomere direction. Using in vitro assays and immunoprecipitation studies, Itoh et al.(1999) showed that the mouse Tjp1, Tjp2, and Tjp3 PDZ1 domains interacted with the C-terminal cytoplasmic domains of Cldn1 through Cldn8. In the mouse inner ear, Walsh et al.(2010) found that Tjp2 expression decreased rapidly between E16.5 and age 1 week to a level in adult mice that was approximately 50% of the level at birth(P0).

Application Notes

Optimal dilution of the Zonula occludens protein 2 antibody should be determined by the researcher.

Immunogen

Amino acids KVKIFEKMDHKARLQRMQELQEAQNARIEIAQKH from the human protein were used as the immunogen for the Zonula occludens protein 2 antibody.

Storage

After reconstitution, the Zonula occludens protein 2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.