• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> YWHAZ Antibody / 14-3-3 zeta/delta

YWHAZ Antibody / 14-3-3 zeta/delta [clone 6G5] (RQ5642)

  Catalog No Formulation Size Price (USD)  
Image RQ5642 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Flow cytometry testing of human PC-3 cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
Flow cytometry testing of human SiHa cells with YWHAZ antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YWHAZ antibody.
Western blot testing of 1) human HeLa, 2) human A549, 3) monkey COS-7, 4) human Raji, 5) human Caco-2, 6) human Jurkat, 7) mouse brain and 8) rat brain lysate with YWHAZ antibody. Predicted molecular weight ~28 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat, Monkey
Format Antigen affinity purified
Clonality Monoclonal
Isotype Mouse IgG2b
Clone Name 6G5
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P63104
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This YWHAZ antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

14-3-3 protein zeta/delta is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

Application Notes

Optimal dilution of the YWHAZ antibody should be determined by the researcher.

Immunogen

Amino acids LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDDKKGIVDQ from the human protein were used as the immunogen for the YWHAZ antibody.

Storage

After reconstitution, the YWHAZ antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.