- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
YAP1 Antibody recognizes Yes-associated protein 1 (YAP1), a transcriptional coactivator and major downstream effector of the Hippo signaling pathway. Originally identified through its interaction with the Src-family kinase YES1, YAP1 lacks intrinsic DNA-binding capability and instead functions by associating with transcription factors such as TEAD1-4, SMADs, RUNX proteins, and p73. Through these interactions, YAP1 regulates the expression of genes involved in cell proliferation, apoptosis, differentiation, stem cell maintenance, and tissue regeneration. Tight control of YAP1 localization and activity is essential for maintaining normal tissue homeostasis and organ size. In response to Hippo pathway activation, LATS kinases phosphorylate YAP1, promoting cytoplasmic retention and proteasomal degradation. Conversely, inhibition of Hippo signaling permits YAP1 nuclear translocation and activation of growth-promoting transcriptional programs.
YAP1 is widely expressed and plays critical roles during embryogenesis and postnatal tissue maintenance. It contributes to the development of the heart, liver, lung, nervous system, and other organs while also participating in wound healing and regeneration. YAP1 functions as an important mechano-transducer, responding to extracellular matrix stiffness, cell density, and mechanical forces that influence cell fate decisions. In stem and progenitor cells, YAP1 signaling supports self-renewal and controls differentiation pathways. Studies in zebrafish, mice, and human tissues have demonstrated that YAP1 activity is indispensable for regeneration of the heart, liver, and skin following injury, underscoring its central role in tissue repair and organ remodeling.
Aberrant YAP1 activation has been implicated in numerous human diseases, particularly cancer. Increased YAP1 expression or constitutive nuclear localization has been reported in hepatocellular carcinoma, pancreatic cancer, breast cancer, colorectal cancer, lung cancer, ovarian cancer, gastric cancer, and glioblastoma. Elevated YAP1 signaling promotes epithelial-mesenchymal transition, angiogenesis, metastasis, cancer stem cell maintenance, and resistance to chemotherapy and targeted therapies. Because YAP1 integrates signals from multiple pathways, including Wnt, TGF-beta, EGFR, PI3K-AKT, and GPCR signaling, it occupies a central position in oncogenic networks. Consequently, YAP1 has emerged as an attractive therapeutic target, and several approaches aimed at disrupting YAP1-TEAD interactions are currently under investigation.
In addition to cancer biology, YAP1 has been linked to fibrosis, cardiovascular disease, pulmonary disorders, and inflammatory processes. Dysregulated YAP1 activity contributes to excessive fibroblast activation and extracellular matrix deposition in organs such as the liver, lung, kidney, and heart. In the cardiovascular system, YAP1 influences cardiomyocyte proliferation and vascular remodeling, while in the nervous system it contributes to neural stem cell maintenance and regeneration. The broad physiological and pathological functions of YAP1 have made it an important biomarker and research target across multiple fields of biology and medicine.
YAP1 Antibody is valuable for investigating Hippo pathway signaling, mechano-transduction, stem cell biology, developmental processes, tissue regeneration, fibrosis, and cancer progression. Because YAP1 serves as a master regulator of growth control and cellular plasticity, its analysis provides important insights into both normal physiology and disease mechanisms. YAP1 Antibody is widely used in studies aimed at understanding cell fate determination, organ repair, tumorigenesis, and the development of novel therapeutic strategies targeting the Hippo-YAP signaling axis.
Learn more about Hippo pathway signaling and related regulatory proteins by visiting our Signal Transduction Antibodies page, which features YAP1 antibodies and other markers involved in cell growth, differentiation, and oncogenic signaling.
Optimal dilution of the YAP1 Antibody / Hippo Pathway Effector Antibody should be determined by the researcher.
Amino acids ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK from the human protein were used as the immunogen for the YAP1 antibody.
After reconstitution, the YAP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
YAP Antibody, Yes-associated protein antibody, Yes-associated protein 1 antibody, YAP65 Antibody, Yorkie homolog antibody, Transcriptional coactivator YAP1 antibody, Yes1 associated transcriptional regulator antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.