• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> YAP1 Antibody

YAP1 Antibody (R32393)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32393 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Immunofluorescent staining of FFPE human SK-OV-3 cells with YAP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
›
Immunofluorescent staining of FFPE human SK-OV-3 cells with YAP1 antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Flow cytometry testing of human HepG2 cells with YAP1 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= YAP1 antibody.
Western blot testing of 1) rat testis, 2) mouse ovary, 3) human HeLa and 4) human MCF7 lysate with YAP1 antibody. Predicted molecular weight: 54 kDa but routinely observed at 65-70 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P46937
Applications Western blot : 0.1-0.5ug/ml
Immunofluorescence (FFPE) : 2-4ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This YAP1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : FACS, WB, ELISA
    Reactivity : Human
  • Applications : DB, ELISA
    Reactivity : Human
    Pred. Reactivity : Chicken, Mouse, Rat
  • Applications : WB, ELISA (peptide)
    Reactivity : Human, Mouse, Rat, Dog

Description

Yes-associated protein 1, also known as YAP or YAP65, is a potent oncogene, which is amplified in various human cancers. This gene encodes a downstream nuclear effector of the Hippo signaling pathway which is involved in development, growth, repair, and homeostasis. It is known to play a role in the development and progression of multiple cancers as a transcriptional regulator of this signaling pathway and may function as a potential target for cancer treatment. Alternative splicing results in multiple transcript variants encoding different isoforms.

Application Notes

Optimal dilution of the YAP1 antibody should be determined by the researcher.

Immunogen

Amino acids ETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFK from the human protein were used as the immunogen for the YAP1 antibody.

Storage

After reconstitution, the YAP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.