• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> WNT7A Antibody

WNT7A Antibody (R31793)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R31793 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Flow cytometry testing of human PC-3 cells with WNT7A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= WNT7A antibody.
›
Flow cytometry testing of human PC-3 cells with WNT7A antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= WNT7A antibody.
Western blot testing of 1) human HCCT, 2) human HCCP, 3) rat kidney, 4) rat liver, 5) mouse kidney and 6) mouse liver tissue lysate with WNT7A antibody. Expected molecular weight ~39 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt O00755
Localization Cytoplasmic
Applications Western blot : 0.5-1ug/ml
Flow cytometry : 1-3ug/million cells
Limitations This WNT7A antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

  • Applications : WB, FACS
    Reactivity : Human, Mouse, Rat

Description

This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas � Rothschild / Schinzel phocomelia syndromes.

Application Notes

Optimal dilution of the WNT7A antibody should be determined by the researcher.

Immunogen

Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.

Storage

After reconstitution, the WNT7A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all Wnt7a antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.