• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Vinexin Antibody / SORBS3

Vinexin Antibody / SORBS3 (RQ6010)

  Catalog No Formulation Size Price (USD)  
Image RQ6010 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE mouse intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE liver cancer with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
IHC staining of FFPE rat intestine with Vinexin antibody. HIER: boil tissue sections in pH8 EDTA for 20 min and allow to cool before testing.
Immunofluorescent staining of FFPE human A549 cells with Vinexin antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH6 citrate buffer for 20 min.
Western blot testing of 1) human ThP-1, 2) rat liver, 3) mouse brain and 4) mouse HEPA1-6 lysate with Vinexin antibody. Predicted molecular weight ~75 kDa.
Flow cytometry testing of human A431 cells with Vinexin antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= CD59 antibody.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt O60504
Localization Nuclear, cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Immunohistochemistry : 1-2ug/ml
Immunofluorescence : 2-4ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This Vinexin antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Vinexin is a protein that in humans is encoded by the SORBS3 gene. It is mapped to 8p21.3. This gene encodes an SH3 domain-containing adaptor protein. The presence of SH3 domains play a role in this protein's ability to bind other cytoplasmic molecules and contribute to cystoskeletal organization, cell adhesion and migration, signaling, and gene expression. Multiple transcript variants encoding different isoforms have been found for this gene.

Application Notes

Optimal dilution of the Vinexin antibody should be determined by the researcher.

Immunogen

Amino acids ASTKIPASQHTQNWSATWTKDSKRRDKRWVKYE from the human protein were used as the immunogen for the Vinexin antibody.

Storage

After reconstitution, the Vinexin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.