- Tel: 858.663.9055
-
Email: info@nsjbio.com
- Tel: 858.663.9055
- Email: info@nsjbio.com
Related Products
|
Villin-1 (VIL1) is an actin-binding, calcium-regulated cytoskeletal protein localized to the apical brush border of epithelial cells, where it plays a central role in microvillus structure and epithelial polarity. Villin Antibody for IF is optimized for fluorescence imaging applications, and this VIL1 Immunofluorescence Antibody enables clear visualization of Villin localization within polarized epithelial cells. Villin antibody, also known as Villin-1 antibody or VIL1 antibody, is widely used in fluorescence-based studies to define epithelial architecture and to highlight brush border-associated cytoskeletal organization with spatial precision.
What differentiates a Villin Antibody for IF from standard Villin reagents is its ability to generate sharp, well-defined fluorescent signals that resolve apical membrane localization. Researchers specifically searching for a VIL1 Immunofluorescence Antibody are typically focused on visualizing polarized distribution, confirming epithelial identity in mixed cell populations, and examining microvillus organization at the cellular level. Villin staining produces a characteristic apical signal pattern, making it especially valuable for identifying epithelial polarity and distinguishing organized epithelial layers from disorganized or dedifferentiated cells.
In immunofluorescence imaging, Villin labeling provides direct visual evidence of brush border integrity and cytoskeletal arrangement. Changes in signal localization, intensity, or continuity can indicate loss of polarity, cytoskeletal disruption, or disease-associated remodeling in epithelial tissues. Because of this, Villin Antibody for IF is frequently used in studies of epithelial differentiation, cancer progression, and tissue organization where spatial distribution of the protein is critical for interpretation rather than bulk protein detection.
Villin is highly expressed in gastrointestinal epithelium and other polarized epithelial tissues, where it regulates actin filament bundling, severing, and capping to maintain microvillus structure. Its strong apical localization and consistent fluorescence pattern make it a reliable marker for epithelial morphology and polarity in imaging studies. This rabbit polyclonal antibody provides robust signal detection and clear visualization of Villin in cells and tissues, making it well suited for researchers prioritizing high-quality immunofluorescence imaging of epithelial cytoskeletal organization using a VIL1 Immunofluorescence Antibody.
Optimal dilution of the Villin Antibody for IF / VIL1 Immunofluorescence Antibody should be determined by the researcher.
Amino acids EQLVNKPVEELPEGVDPSRKEEHLSIEDFT of human Villin were used as the immunogen for the Villin Antibody for IF / VIL1 Immunofluorescence Antibody.
After reconstitution, the Villin antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.
Villin-1 antibody, VIL1 antibody, Villin 1 antibody, Villin antibody
Your bulk quote request has been submitted successfully!
Please contact us if you have any questions.