• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> VEGF Receptor 1 Antibody / VEGFR1 / FLT1

VEGF Receptor 1 Antibody / VEGFR1 / FLT1 (RQ4033)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image RQ4033 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 429
Bulk quote request
Western blot testing of 1) rat kidney, 2) mouse liver and 3) mouse HEPA1-6 lysaste with VEGF Receptor 1 antibody at 0.5ug/ml. Predicted molecular weight ~150 kDa.
Western blot testing of 1) rat kidney, 2) mouse liver and 3) mouse HEPA1-6 lysaste with VEGF Receptor 1 antibody at 0.5ug/ml. Predicted molecular weight ~150 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity purified
Buffer Lyophilized from 1X PBS with 2% Trehalose and 0.025% sodium azide
UniProt P17948
Applications Western Blot : 0.5-1ug/ml
Limitations This VEGF Receptor 1 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

Vascular endothelial growth factor receptor 1 (FLT1) is a protein that in humans is encoded by the FLT1 gene. Oncogene FLT belongs to the src gene family. It is mapped to 13q12. The deduced 1,338-amino acid protein has a calculated molecular mass of 150.6 kD. It has a 758-amino acid extracellular domain, followed by a 22-amino acid transmembrane region and a 558-amino acid cytoplasmic region containing a cluster of basic amino acids and a tyrosine kinase domain. sFLT-1 was identified in placenta, adult lung, kidney, liver and uterus. Like other members of this family, it shows tyrosine protein kinase activity that is important for the control of cell proliferation and differentiation.

Application Notes

Optimal dilution of the VEGF Receptor 1 antibody should be determined by the researcher.

Immunogen

Amino acids DPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE from the human protein were used as the immunogen for the VEGF Receptor 1 antibody.

Storage

After reconstitution, the VEGF Receptor 1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all VEGFR1 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.