• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Order
Home >> Antibodies >> UBE2Q2 Antibody / Ubiquitin carrier protein Q2

UBE2Q2 Antibody / Ubiquitin carrier protein Q2 (R32289)

NSJ bio Image Pdf Image
  Catalog No Formulation Size Price (USD)  
Image R32289 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Flow cytometry testing of fixed and permeabilized human HepG2 cells with UBE2Q2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UBE2Q2 antibody.
›
Flow cytometry testing of fixed and permeabilized human HepG2 cells with UBE2Q2 antibody at 1ug/million cells (blocked with goat sera); Red=cells alone, Green=isotype control, Blue= UBE2Q2 antibody.
Western blot testing of 1) human placenta, 2) human HeLa, 3) human U-87 MG, 4) human 293T, 5) rat stomach, 6) rat pancreas and 7) mouse pancreas tissue lysate with UBE2Q2 antibody. Predicted molecular weight ~43 kDa, routinely observed at 43-46 kDa.
Availability 1-3 business days
Species Reactivity Human, Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2% Trehalose
UniProt Q8WVN8
Localization Cytoplasmic
Applications Western Blot : 0.5-1ug/ml
Flow Cytometry : 1-3ug/million cells
Limitations This UBE2Q2 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

UBE2Q2 (Ubiquitin carrier protein Q2) is a member of the ubiquitin-conjugating enzyme (E2) family, which plays an essential role in the ubiquitin-proteasome system. These enzymes catalyze the transfer of ubiquitin from an E1 activating enzyme to substrate proteins, usually in cooperation with E3 ligases. Through this activity, UBE2Q2 helps regulate protein turnover, signaling pathways, and cellular homeostasis. A UBE2Q2 antibody is often employed to investigate protein degradation, cell cycle regulation, and ubiquitin signaling in diverse biological systems.

UBE2Q2 has been detected in multiple tissues and cell types, with enrichment noted in the brain, liver, and testis. Its expression patterns suggest important roles in both development and disease. Recent studies have implicated UBE2Q2 in tumor biology, including colorectal, lung, and breast cancers, where dysregulation of ubiquitin-conjugating enzymes can alter cell survival and proliferation. Using a UBE2Q2 antibody enables researchers to study its contribution to these processes and assess its potential as a biomarker.

Beyond cancer research, UBE2Q2 has also been associated with neurological and metabolic functions due to its role in protein homeostasis. As part of the broader ubiquitin system, it may influence stress response pathways and protein quality control mechanisms. Employing a UBE2Q2 antibody provides an effective means to evaluate expression levels and molecular interactions of this enzyme in both physiological and pathological contexts.

NSJ Bioreagents offers a high-quality UBE2Q2 antibody validated for applications including western blot, immunohistochemistry, and immunofluorescence. Choosing a UBE2Q2 antibody from NSJ Bioreagents ensures reliable performance and reproducible results in studies of ubiquitin biology, cancer, and cellular regulation.

Application Notes

Optimal dilution of the UBE2Q2 antibody should be determined by the researcher.

Immunogen

Amino acids LERLEDTKNNNLLRQQLKWLICELCSLYNLPKHLDVEMLDQ of human UBE2Q2 were used as the immunogen for the UBE2Q2 antibody.

Storage

After reconstitution, the UBE2Q2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Related Products

   1.   View all UBE2Q2 antibodies

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.