• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> Tyrosine Hydroxylase Antibody / TH

Tyrosine Hydroxylase Antibody / TH (R31900)

  Catalog No Formulation Size Price (USD)  
Image R31900 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 419
Bulk quote request
Immunofluorescent staining of FFPE mouse brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE mouse brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
Immunofluorescent staining of FFPE rat brain tissue with Tyrosine Hydroxylase antibody (green) and DAPI nuclear stain (blue). HIER: steam section in pH8 EDTA buffer for 20 min.
IHC testing of FFPE mouse brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
IHC testing of FFPE rat brain with Tyrosine Hydroxylase antibody. HIER: Boil the paraffin sections in pH8 EDTA buffer for 20 minutes and allow to cool prior to staining.
Western blot testing of 1) rat brain and 2) mouse brain lysate with Tyrosine Hydroxylase antibody. Expected molecular weight 55~60 kDa.
Availability 1-3 business days
Species Reactivity Mouse, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA and 0.025% sodium azide
UniProt P07101
Applications Western blot : 0.1-0.5ug/ml
Immunohistochemistry (FFPE) : 2-5ug/ml
Immunofluorescence : 5ug/ml
Limitations This Tyrosine Hydroxylase antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Related Products

Description

TH / Tyrosine hydroxylase is involved in the conversion of tyrosine to dopamine. It is the rate-limiting enzyme in the synthesis of catecholamines, hence plays a key role in the physiology of adrenergic neurons. Mutations in this gene have been associated with autosomal recessive Segawa syndrome. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. In humans, tyrosine hydroxylase is encoded by the TH gene, and the enzyme is present in the central nervous system (CNS), peripheral sympathetic neurons and the adrenal medulla. Tyrosine hydroxylase, phenylalanine hydroxylase and tryptophan hydroxylase together make up the family of aromatic amino acid hydroxylases (AAAHs).

Application Notes

Optimal dilution of the Tyrosine Hydroxylase antibody should be determined by the researcher.

Immunogen

Amino acids KVPWFPRKVSELDKCHHLVTKFDPDLDLDH of human TH were used as the immunogen for the Tyrosine Hydroxylase antibody.

Storage

After reconstitution, the Tyrosine Hydroxylase antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.