• Tel: 858.663.9055
  • SeparatorEmail: info@nsjbio.com
  • Tel: 858.663.9055
  • Email: info@nsjbio.com
Home >> Antibodies >> TSG6 Antibody

TSG6 Antibody (R32752)

  Catalog No Formulation Size Price (USD)  
Image R32752 0.5mg/ml if reconstituted with 0.2ml sterile DI water 100 ug 439
Bulk quote request
Western blot testing of 1) rat brain and 2) human HeLa lysate with TSG6 antibody at 0.5ug/ml. Predicted molecular weight ~31 kDa.
Availability 1-3 business days
Species Reactivity Human, Rat
Format Antigen affinity purified
Clonality Polyclonal (rabbit origin)
Isotype Rabbit IgG
Purity Antigen affinity
Buffer Lyophilized from 1X PBS with 2.5% BSA, 0.025% sodium azide
UniProt P98066
Applications Western Blot : 0.5-1ug/ml
Limitations This TSG6 antibody is available for research use only.
Review this product on BioCompare and get a $20 Amazon gift card

Description

Tumor necrosis factor-inducible gene 6 protein, also known as TSG-6, is a protein that in humans is encoded by the TNFAIP6 gene. The protein encoded by this gene is a secretory protein that contains a hyaluronan-binding domain, and thus is a member of the hyaluronan-binding protein family. The hyaluronan-binding domain is known to be involved in extracellular matrix stability and cell migration. This protein has been shown to form a stable complex with inter-alpha-inhibitor (I alpha I), and thus enhance the serine protease inhibitory activity of I alpha I, which is important in the protease network associated with inflammation. This gene can be induced by proinflammatory cytokines such as tumor necrosis factor alpha and interleukin-1. Enhanced levels of this protein are found in the synovial fluid of patients with osteoarthritis and rheumatoid arthritis.

Application Notes

Optimal dilution of the TSG6 antibody should be determined by the researcher.

Immunogen

Amino acids 46-91 (KYKLTYAEAKAVCEFEGGHLATYKQLEAARKIGFHVCAAGWMAKGR) from the human protein were used as the immunogen for the TSG6 antibody.

Storage

After reconstitution, the TSG6 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

Cross
Bulk Quote Request Form
Name*:
Organization*:
Email*:
Phone Number*:
Catalog No.*:
Comments and Specifics(amount, formulation, etc.)*:
Validation code: Captchapackage Image


Can't read the image? click here to refresh.
    *required field

Your bulk quote request has been submitted successfully!

Please contact us if you have any questions.